PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_37104.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 330aa    MW: 36942.5 Da    PI: 6.8028
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_37104.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.22.8e-52191451128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                   lppGfrFhPtd+elv +yL++k++g++l++  +i+evd+y+++Pw Lp ++  +++ewyfF++rd+ky++g+r+nra+ +gyWkatg dk+v  ++g
  MLOC_37104.2  19 LPPGFRFHPTDDELVEHYLCRKAAGQRLPV-PIIAEVDLYRFDPWALPDRALFGTREWYFFTPRDRKYPNGSRPNRAAGNGYWKATGADKPVAPRGG 114
                   79****************************.88***************77778999***************************************** PP

           NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                   +++g+kk Lvfy g+apkg+ktdW+mheyrl
  MLOC_37104.2 115 RTMGIKKALVFYAGKAPKGVKTDWIMHEYRL 145
                   *****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-6415172IPR003441NAC domain
PROSITE profilePS5100560.21519172IPR003441NAC domain
PfamPF023652.2E-2720145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MGMPAARRRE RDAEAELNLP PGFRFHPTDD ELVEHYLCRK AAGQRLPVPI IAEVDLYRFD  60
PWALPDRALF GTREWYFFTP RDRKYPNGSR PNRAAGNGYW KATGADKPVA PRGGRTMGIK  120
KALVFYAGKA PKGVKTDWIM HEYRLADAGR AAASKKGSLR LDDWVLCRLY NKKNEWEKMQ  180
LQQQQGEGET MMEPKAEENT ASDMVVTSHS HSQSQSHSHS WGEARTPESE IVDNDPSLFH  240
QAQATAFQTQ SPAAAAAHQE MMATLMVPKK EAADEGRNDL FVDLSYDDIQ SMYNGLDMMP  300
PGDDLLYSSF FASPRVRGSQ PGSGGMPAPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-10811781174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2491020.0AK249102.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf19c03, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563852.11e-163PREDICTED: NAC domain-containing protein 67-like
SwissprotQ52QH41e-107NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBLF6MEL20.0F6MEL2_HORVD; Stress-induced transcription factor SNAC1
STRINGMLOC_37104.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44143071
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.13e-86NAC family protein